PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07223A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 130aa    MW: 15214.5 Da    PI: 10.522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07223AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161663148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W++eEde+l+  ++++G  +W++I++  g+ R++k+c++rw +yl
  Oropetium_20150105_07223A 16 KGLWSPEEDERLASHIARFGVSCWSSIPELTGLQRCGKSCRLRWMNYL 63
                               678*******************************************97 PP

2Myb_DNA-binding49.97.4e-1669111145
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                rgr++++E++l++ ++k lG+  W+ Ia++++ gR+++++k++w+
  Oropetium_20150105_07223A  69 RGRFSQQEEDLIIALHKTLGNS-WSQIAARLP-GRSDNEIKNFWN 111
                                89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-23866IPR009057Homeodomain-like
PROSITE profilePS5129416.1371163IPR017930Myb domain
SuperFamilySSF466892.13E-2814110IPR009057Homeodomain-like
SMARTSM007173.4E-111565IPR001005SANT/Myb domain
PfamPF002497.8E-151663IPR001005SANT/Myb domain
CDDcd001675.83E-91963No hitNo description
PROSITE profilePS5129423.98164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2667118IPR009057Homeodomain-like
SMARTSM007174.3E-1568116IPR001005SANT/Myb domain
PfamPF002492.2E-1469111IPR001005SANT/Myb domain
CDDcd001672.79E-971111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MERMHPCCSE EKKLRKGLWS PEEDERLASH IARFGVSCWS SIPELTGLQR CGKSCRLRWM  60
NYLRPDLKRG RFSQQEEDLI IALHKTLGNS WSQIAARLPG RSDNEIKNFW NARLRKKLRQ  120
KHFNSYVNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118RLRKKLR
2113119LRKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008675683.16e-81PREDICTED: myb-related protein Hv33-like
SwissprotQ8LPH62e-59MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A096QND56e-81A0A096QND5_MAIZE; Uncharacterized protein
STRINGGRMZM2G052377_P012e-80(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144481725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-60myb domain protein 86